Peptide Inhibitors

Online Inquiry
Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
CAT# Product Name M.W Molecular Formula Inquiry
R2071 Mibenratide 2097.3 C87H129N27O30S2 Inquiry
R2072 Nelipepimut-S 995.2 C50H78N10O11 Inquiry
R2073 Reversin 121 641.8 C34H47N3O9 Inquiry
R2074 Barusiban 830.05 C40H63N9O8S Inquiry
R2075 Dolcanatide 1681.9 C65H104N18O26S4 Inquiry
R2076 GE 2270A 1290.52 C56H55N15O10S6 Inquiry
R2077 SKF107457 577.71 C29H47N5O7 Inquiry
R2078 Binetrakin Inquiry
R2079 Friulimicin D 1317.49 C60H96N14O19 Inquiry
R2080 Pancreatic polypeptide 4182.70 C185H286N52O55S2 Inquiry
R2081 Argifin 675.7 C29H41N9O10 Inquiry
R2082 Alsactide 2119.53 C99H155N29O21S Inquiry
R2083 DV-40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 4330 C194H295N53O58S Inquiry
R2084 Ac-Epithalon Inquiry
R2085 N-Acetyl-Epitalon-Amidate Inquiry
R2086 FNIII 14 Peptide TEATITGLEPGTEYTITYVIAL 2356.65 C107H170N22O37 Inquiry
R2087 chensinin-1b Inquiry
R2088 PE 22-28 773.9 C35H55N11O9 Inquiry
R2089 C(RGDyC) 594.6 C24H34N8O8S Inquiry
R2090 Exendin-4 4187 C184H282N50O60S Inquiry
Quick Inquiry
×
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.