DV-40 is a 40-residue peptide comprising hydrophilic, aromatic, and hydrophobic clusters that drive complex folding and aggregation behavior. The sequence allows examination of β-structure formation, membrane interactions, and oligomer kinetics. Researchers use it in high-resolution biophysical assays and structural modeling. Its length supports detailed aggregation-pathway analysis.
CAT No: R2083
CAS No:131438-79-4
Synonyms/Alias:beta-Amyloid 1-40;131438-79-4;Abeta40;Human beta-amyloid peptide (1-40);Abeta40 [MI];Abeta(1-40);beta-Amyloid protein(1-40);UNII-13539D6GO8;Human beta-amyloid peptide-(1-40);Amyloid beta peptide(1-40) (synthetic);13539D6GO8;Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val;beta-Amyloid (1-40);Beta-Amyloid(1-40);beta-amyloid 40;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV;Beta-amyloid protein 40;CHEBI:64646;Amyloid beta-Peptide 1-40 TFA
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.