Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGKAGM |
Activity | Antibacterial |
Host Chemicals | Lactobacillus sake Lb 706 |
Length | 41 |
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
5. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.