Keywords Search Google Search Search

Sakacin A

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2865
Sequence	ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGKAGM
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2426	Vicin-like antimicrobial peptide 2d	Inquiry
AF759	Antimicrobial peptide odorranain-O3	Inquiry
AF199	Temporin-CG1	Inquiry
AF634	BTD-2	Inquiry
AF1417	Nigroain-D antimicrobial peptide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Effect of GRF (Human) Acetate on Growth Hormone

Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

The Function of Darifenacin Hydrobromide in over Active Bladder

Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Lactobacillus sake Lb 706
Length	41