CAT# | U02006 |
M.F/Formula | C186H311N51O53S2 |
M.W/Mr. | 4174.0 |
Sequence | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...