Urocortin III, mouse, free acid

Urocortin III, mouse, free acid is a CRF-related peptide whose acidic terminus influences solubility and conformational sampling. Its sequence supports studies of helical transitions and receptor-binding tendencies. Hydrophobic regions stabilize folding. Researchers examine it in cross-species analyses of urocortin peptides.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: U02006

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C186H311N51O53S2
M.W/Mr.
4174.0
Sequence
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI
Length
38

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesEpitope Mapping ServicesPeptide Analysis ServicesPeptide CDMOPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers