Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN |
Activity | Antimicrobial |
Host Chemicals | Viola philippica |
Length | 31 |
1. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.