Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK |
Activity | Cancer cells |
Host Chemicals | Viscum album L |
Length | 46 |
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.