Home > Product > Antimicrobial Peptides > Viscotoxin 1-PS

Antimicrobial Peptides

Viscotoxin 1-PS

Price Inquiry
CAT#
AF3203
Sequence
KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK
Host Chemicals
Viscum album L
Length
46
Activity
Cancer cells

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.