Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C164H245N45O53S5.xC2HF3O2 |
M.W/Mr. | 3855.29 (free base) |
Sequence | One Letter Code:ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) Three Letter Code:Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23) |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
3. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
4. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
5. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com