Wasabi Receptor Toxin TFA

Wasabi Receptor Toxin TFA is a peptide toxin that interacts with TRPA1-like channels through its structured arrangement of cysteines, aromatic residues, and charged groups. Researchers study its folding stability and ion-channel modulation. Applications include toxin-structure characterization, receptor-motif analysis, and electrophysiological mapping.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2832

Synonyms/Alias:WaTx TFA

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C164H245N45O53S5.xC2HF3O2
M.W/Mr.
3855.29 (free base)
Sequence
One Letter Code:ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)
Three Letter Code:Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)

Wasabi Receptor Toxin TFA is a peptide toxin derived from the venom of the Australian black rock scorpion, recognized for its unique ability to target and modulate the activity of specific ion channels, particularly the transient receptor potential ankyrin 1 (TRPA1) channel, commonly known as the wasabi receptor. As a synthetic peptide supplied as a trifluoroacetate (TFA) salt, it serves as a critical molecular tool for dissecting the mechanisms of sensory perception, pain signaling, and ion channel pharmacology. Its high selectivity and potency have made it an invaluable reagent in the investigation of nociceptive pathways and the molecular underpinnings of chemical irritant responses. Researchers utilize Wasabi Receptor Toxin TFA to advance understanding of ion channel modulation and to probe the physiological roles of TRPA1 in diverse biological systems.

Ion Channel Research: Wasabi Receptor Toxin TFA is extensively employed in the study of TRPA1 channel function, providing a powerful means to selectively activate or inhibit this receptor in vitro and ex vivo. By enabling precise modulation of TRPA1 activity, the peptide allows researchers to delineate the downstream signaling events triggered by channel activation, including calcium influx and associated cellular responses. Its use facilitates the identification of TRPA1-dependent pathways and supports the characterization of channel pharmacology, contributing to a deeper understanding of sensory transduction mechanisms.

Pain and Sensory Pathway Investigation: The peptide toxin is a valuable tool for exploring the molecular basis of nociception and chemical irritant detection. By selectively targeting the wasabi receptor, it enables functional studies of pain-sensing neurons and their response to environmental stimuli. Researchers utilize it to dissect the signaling cascades involved in acute and chronic pain models, elucidating the specific contributions of TRPA1 in sensory neuron activation and the broader context of peripheral sensory processing.

Pharmacological Screening: Wasabi Receptor Toxin TFA is instrumental in high-throughput screening platforms designed to identify novel modulators of TRPA1 activity. Its well-characterized mechanism of action makes it an ideal positive control or reference compound in assays evaluating the efficacy or selectivity of small molecules, peptides, or biologics targeting TRPA1. This application accelerates the discovery and characterization of new pharmacological agents that interact with the wasabi receptor, supporting both academic and industrial research initiatives.

Neurobiology and Signal Transduction Studies: The selective action of the toxin on TRPA1 channels renders it a key reagent in neurobiological research focused on sensory neuron function and signal transduction. By applying the peptide to cultured neurons or tissue preparations, investigators can monitor real-time changes in neuronal excitability, intracellular signaling, and gene expression patterns. These experiments provide critical insights into the cellular and molecular mechanisms that govern sensory perception and adaptation to noxious stimuli.

Peptide Structure-Function Analysis: As a well-defined scorpion-derived peptide, Wasabi Receptor Toxin TFA is also utilized in structure-function studies to elucidate the relationship between peptide sequence, conformation, and biological activity. Researchers employ it as a template for designing analogs or modified peptides to probe the determinants of TRPA1 specificity and potency. Such investigations contribute to the broader field of peptide engineering and ion channel-targeted probe development, informing the rational design of new molecular tools for sensory biology research.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesEpitope Mapping ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide Synthesis ServicesPeptide CDMOPeptide Nucleic Acids SynthesisCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers