Wasabi Receptor Toxin TFA

Wasabi Receptor Toxin TFA is a peptide toxin that interacts with TRPA1-like channels through its structured arrangement of cysteines, aromatic residues, and charged groups. Researchers study its folding stability and ion-channel modulation. Applications include toxin-structure characterization, receptor-motif analysis, and electrophysiological mapping.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2832

Synonyms/Alias:WaTx TFA

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C164H245N45O53S5.xC2HF3O2
M.W/Mr.
3855.29 (free base)
Sequence
One Letter Code:ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)
Three Letter Code:Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser (Disulfide bridge: Cys9-Cys27; Cys13-Cys23)

Wasabi Receptor Toxin TFA, also known as WaTx TFA, is a specialized peptide derived from the venom of the Australian black rock scorpion. This compound is renowned for its highly selective action on the transient receptor potential ankyrin 1 (TRPA1) ion channel, which is often referred to as the “wasabi receptor” due to its role in mediating the pungent sensation elicited by wasabi and other irritants. With its unique molecular structure, Wasabi Receptor Toxin TFA demonstrates remarkable specificity and potency, making it an invaluable tool in the study of sensory biology and ion channel pharmacology. Researchers value its ability to precisely modulate TRPA1 activity, facilitating the dissection of complex signaling pathways involved in pain, inflammation, and sensory perception. The synthetic TFA salt form further enhances its solubility and stability, supporting its consistent performance in a variety of experimental systems, including cell-based assays, electrophysiological recordings, and biochemical studies.

Ion Channel Research: In the field of ion channel research, Wasabi Receptor Toxin TFA serves as a powerful probe for investigating the biophysical properties and physiological roles of TRPA1 channels. By selectively binding and activating TRPA1, WaTx TFA enables researchers to characterize channel gating mechanisms, identify critical amino acid residues involved in ligand recognition, and delineate the downstream signaling events triggered by receptor activation. The toxin's high specificity helps distinguish TRPA1-mediated responses from those of closely related channels, providing clarity in functional studies and facilitating the development of targeted modulators.

Pain Signaling Pathway Elucidation: WaTx TFA is extensively employed in studies aimed at unraveling the molecular underpinnings of pain signaling. By mimicking the action of endogenous irritants, the toxin allows scientists to activate TRPA1 in a controlled manner, thereby enabling the mapping of neuronal circuits and signaling cascades responsible for nociceptive processing. Its use in in vitro and ex vivo preparations has provided critical insights into the mechanisms by which TRPA1 contributes to acute and chronic pain, as well as its interplay with other sensory transducers.

Neurobiology of Sensory Perception: Researchers investigating the neurobiology of sensory perception utilize Wasabi Receptor Toxin TFA to probe the role of TRPA1 in detecting environmental irritants and modulating sensory neuron excitability. Through targeted application of the toxin, studies have elucidated the contribution of TRPA1 to chemosensation, thermosensation, and mechanosensation, shedding light on how sensory neurons integrate diverse stimuli to generate appropriate physiological responses. This has advanced the understanding of sensory coding and adaptation at the cellular and systems levels.

Inflammation Mechanisms: The involvement of TRPA1 in inflammatory processes has made WaTx TFA a valuable asset in inflammation research. By selectively activating TRPA1-expressing cells, the toxin enables the study of downstream inflammatory mediators, cytokine release, and the recruitment of immune cells. These investigations have highlighted the role of TRPA1 as a key sensor of oxidative and chemical stress, providing a mechanistic framework for its contribution to tissue inflammation and hypersensitivity.

Drug Discovery and Screening: In the context of drug discovery, Wasabi Receptor Toxin TFA is employed as a reference agonist or positive control in high-throughput screening assays designed to identify novel TRPA1 modulators. Its reproducible and robust activation of TRPA1 channels facilitates the validation of assay platforms, benchmarking of compound libraries, and evaluation of structure-activity relationships. The toxin's utility in these applications accelerates the identification of candidate molecules with potential therapeutic relevance for sensory disorders and pain management.

WaTx TFA's multifaceted applications underscore its significance in advancing fundamental and translational research across a range of disciplines. By enabling precise manipulation of TRPA1 function, it continues to drive discoveries in ion channel physiology, sensory neuroscience, and inflammation biology, while supporting the development of innovative screening strategies in pharmaceutical research. As interest in TRPA1-targeted interventions grows, Wasabi Receptor Toxin TFA remains an indispensable resource for elucidating complex biological processes and fostering the next generation of scientific breakthroughs.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide CDMOEpitope Mapping ServicescGMP Peptide ServicePeptide Modification ServicesPeptide Synthesis ServicesPeptide Analysis ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers