Keywords Search Google Search Search

Abaecin precursor

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2401
Sequence	YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2343	Defr1	Inquiry
AF1074	PAM2	Inquiry
AF565	Histone H2B 3	Inquiry
AF089	Antifungal peptide 1	Inquiry
AF1977	CGA 41-70	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Gonadorelin Acetate in Central Precocious Puberty

Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

Peptidic Antagonist to CRF2 Receptor–Astressin 2B

Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...

GaTx2, a Peptide Inhibitor of ClC-2 Chloride Channels

ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...

Liraglutide for type 2 diabetes and weight loss

Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Apis mellifera
Length	34
SwissProt ID	P15450