CAT# | AF2401 |
Sequence | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
Activity | Antibacterial |
Host Chemicals | Apis mellifera | Length | 34 | SwissProt ID | P15450 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1003 | Human Histatin 4 | Inquiry | ||
AF2028 | Vico A | Inquiry | ||
AF409 | Odorranain-A-RA1 peptide precursor, partial | Inquiry | ||
AF1378 | Salivary glands defensin | Inquiry | ||
AF3079 | ENAP-1 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...