CAT# | AF2401 |
Sequence | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
Activity | Antibacterial |
Host Chemicals | Apis mellifera | Length | 34 | SwissProt ID | P15450 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF970 | Nigrocin-OG13 | Inquiry | ||
AF897 | Oncopeltus antibacte-rial peptide 4 | Inquiry | ||
AF1561 | Defensin-related cryptdin-related sequence 12 | Inquiry | ||
AF1503 | Metchnikowin-2 | Inquiry | ||
AF796 | Dahlein 5.3 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...