ACTH (1-39), PORCINE

ACTH (1-39), PORCINE corresponds to the full porcine adrenocorticotropic hormone sequence, preserving motifs central to peptide folding and receptor engagement. The peptide enables studies of biosynthesis, structural transitions, and enzymatic cleavage. Researchers apply it to examine cross-species differences in ACTH behavior. Its extended length supports biophysical and biochemical investigations.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
ACTH (1-39), PORCINE(CAS 9061-27-2)

CAT No: HB00091

CAS No:9061-27-2

Synonyms/Alias:alpha1-39-Corticotropin (pig);9061-27-2;Corticotropin porcine;EINECS 232-946-7;UNII-FP33F50XKB;FP33F50XKB;CHEMBL3274100;232-946-7;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C210H314N56O57S
M.W/Mr.
4567
Sequence
One Letter Code:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF
Three Letter Code:H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Leu-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH

ACTH (1-39), Porcine, also known as adrenocorticotropic hormone derived from porcine sources, is a polypeptide consisting of 39 amino acids that plays a pivotal role in the regulation of the adrenal cortex. As a peptide hormone, it is structurally and functionally conserved across species, making porcine ACTH a valuable tool in various research settings. Its biological activity stems from its ability to stimulate the production and release of glucocorticoids, mineralocorticoids, and androgens from the adrenal glands. The porcine-derived sequence closely mirrors that of other mammals, ensuring broad applicability in comparative studies. Researchers often utilize this compound to explore endocrine signaling pathways, dissect the molecular mechanisms underlying stress responses, and investigate adrenal gland physiology. Its stability and compatibility with a range of experimental systems further enhance its utility in both in vitro and in vivo applications, facilitating advancements in biochemical, pharmacological, and physiological research.

Endocrinology Research: In studies focused on endocrine system regulation, ACTH (1-39), Porcine serves as an essential reagent for modeling the hypothalamic-pituitary-adrenal (HPA) axis. By mimicking endogenous ACTH activity, it enables researchers to probe the feedback mechanisms controlling cortisol secretion and to elucidate the interplay between pituitary-derived hormones and adrenal responses. This approach supports the investigation of hormonal imbalances, stress adaptation, and the dynamic regulation of steroidogenesis, providing critical insights into the fundamental processes governing endocrine homeostasis.

Adrenal Physiology Studies: Porcine ACTH is frequently employed to stimulate adrenal cortical cells in both tissue cultures and animal models. Through controlled administration, scientists can assess the steroidogenic capacity of adrenal tissues, map the biosynthetic pathways of corticosteroids, and characterize the cellular responses to trophic stimulation. This application is particularly valuable for delineating the molecular events that govern adrenal growth, differentiation, and hormone output, contributing to a deeper understanding of adrenal gland function under physiological and experimental conditions.

Comparative Biology and Evolution: The conserved structure of ACTH (1-39) across vertebrates makes the porcine variant an ideal candidate for comparative biological studies. Researchers leverage its cross-reactivity to investigate evolutionary adaptations in the HPA axis among different species, analyzing sequence variation, receptor binding affinities, and functional outcomes. Such studies provide a framework for understanding the evolutionary pressures that have shaped endocrine regulation and highlight species-specific features of hormone signaling.

Pharmacological Screening: In drug discovery and development, ACTH (1-39), Porcine is utilized to evaluate the efficacy and selectivity of compounds targeting adrenal steroidogenesis. By serving as a standardized stimulant, it facilitates the assessment of potential therapeutic agents' impacts on hormone production, receptor modulation, and downstream signaling pathways. This application aids in the identification of novel modulators of adrenal function, supporting the development of new pharmacological strategies for managing disorders related to steroid hormone imbalance.

Peptide Receptor Characterization: The interaction of porcine ACTH with melanocortin receptors, particularly MC2R, is a focal point for receptor biochemistry research. Scientists use it to characterize receptor-ligand binding kinetics, signal transduction cascades, and receptor desensitization or internalization processes. These studies advance the understanding of G protein-coupled receptor (GPCR) dynamics and inform the design of receptor-specific agonists or antagonists, broadening the scope of peptide hormone pharmacology and receptor biology research.

Biotechnological Applications: Beyond basic research, ACTH (1-39), Porcine finds utility in the development and optimization of bioassays and diagnostic tools. Its reliable bioactivity makes it suitable for calibrating assay systems that quantify adrenal hormone output or screen for adrenal responsiveness in various biological samples. Additionally, it is used as a reference standard in the validation of analytical methods and in the quality control of peptide-based reagents. By enabling precise, reproducible measurements and facilitating the standardization of experimental protocols, porcine ACTH contributes to the advancement of both research and applied biotechnology sectors.

Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C210H314N56O57S/c1-110(2)91-143(189(304)234-116(12)173(288)237-135(68-73-163(275)276)178(293)233-117(13)174(289)256-151(95-119-43-20-16-21-44-119)205(320)265-88-37-56-155(265)196(311)254-144(92-111(3)4)190(305)243-139(72-77-167(283)284)186(301)258-153(207(322)323)97-120-45-22-17-23-46-120)249-184(299)138(71-76-166(281)282)244-194(309)150(101-168(285)286)253-183(298)136(69-74-164(277)278)238-172(287)115(11)232-160(272)104-228-177(292)149(100-159(216)271)255-197(312)156-57-38-89-266(156)206(321)152(96-122-62-66-126(270)67-63-122)257-202(317)170(113(7)8)260-188(303)132(51-28-32-81-213)246-201(316)171(114(9)10)262-199(314)158-59-40-87-264(158)204(319)142(55-36-85-226-210(221)222)247-181(296)133(53-34-83-224-208(217)218)240-180(295)131(50-27-31-80-212)239-179(294)130(49-26-30-79-211)235-161(273)106-230-200(315)169(112(5)6)261-198(313)157-58-39-86-263(157)203(318)141(52-29-33-82-214)236-162(274)105-229-176(291)147(98-123-102-227-129-48-25-24-47-127(123)129)251-182(297)134(54-35-84-225-209(219)220)241-191(306)146(93-118-41-18-15-19-42-118)250-193(308)148(99-124-103-223-109-231-124)252-185(300)137(70-75-165(279)280)242-187(302)140(78-90-324-14)245-195(310)154(108-268)259-192(307)145(248-175(290)128(215)107-267)94-121-60-64-125(269)65-61-121/h15-25,41-48,60-67,102-103,109-117,128,130-158,169-171,227,267-270H,26-40,49-59,68-101,104-108,211-215H2,1-14H3,(H2,216,271)(H,223,231)(H,228,292)(H,229,291)(H,230,315)(H,232,272)(H,233,293)(H,234,304)(H,235,273)(H,236,274)(H,237,288)(H,238,287)(H,239,294)(H,240,295)(H,241,306)(H,242,302)(H,243,305)(H,244,309)(H,245,310)(H,246,316)(H,247,296)(H,248,290)(H,249,299)(H,250,308)(H,251,297)(H,252,300)(H,253,298)(H,254,311)(H,255,312)(H,256,289)(H,257,317)(H,258,301)(H,259,307)(H,260,303)(H,261,313)(H,262,314)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,283,284)(H,285,286)(H,322,323)(H4,217,218,224)(H4,219,220,225)(H4,221,222,226)/t115-,116-,117-,128-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,169-,170-,171-/m0/s1
InChI Key
XFBDTKGDXZDJAN-WODOTNDISA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesEpitope Mapping ServicesPeptide Analysis ServicesPeptide Synthesis ServicesPeptide CDMOCustom Conjugation ServicePeptide Nucleic Acids SynthesiscGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers