1. Home
  2. Products
  3. Catalog Peptides
  4. Others Catalog Peptides
  5. Adropin (34-76) (human, mouse, rat) trifluoroacetate salt

Adropin (34-76) (human, mouse, rat) trifluoroacetate salt

Adropin (34-76) (human, mouse, rat) trifluoroacetate salt represents a conserved region of the peptide used to explore metabolic signaling frameworks. Its amphipathic sequence supports folding analyses and receptor-binding studies across species. The fragment aids in studying structural determinants of peptide-protein communication. Applications include biosynthesis research and peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C0022

CAS No:1802086-30-1

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₉₀H₂₉₃N₅₅O₆₈S₂
M.W/Mr.
4499.88
Sequence
One Letter Code: CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
three Letter Code: H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH (Disulfide bond)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Modification ServicescGMP Peptide ServicePeptide CDMOCustom Conjugation ServicePeptide Synthesis ServicesEpitope Mapping Services
Hot Products
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Read More Read More
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
Somatostatin

Somatostatin peptide inhibits the secretion of growth hormone and insulin. Purchase high-purity Somatostatin for metabolic, neuroendocrine, and cancer research.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) acetate is a metal-chelating cyclic RGD peptide used to investigate integrin-binding motifs. Its cyclized structure stabilizes ligand presentation for receptor-targeting studies. Researchers analyze its conformation for high-affinity binding models. The DOTA moiety supports imaging-related biochemical experiments.

Read More Read More
Aviptadil Acetate

Aviptadil Acetate is a vasoactive intestinal peptide for lung and immune research. Purchase this synthetic peptide for studies on pulmonary health and inflammation.

Read More Read More
Angiotensin II

Angiotensin II peptide regulates blood pressure and vascular constriction. Purchase this synthetic research peptide to support cardiovascular and renal function studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers