Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
CAT No: R1190
CAS No:124447-81-0
Synonyms/Alias:Amylin (rat);124447-81-0;Amylin (mouse, rat) trifluoroacetate salt;DA-50442;FA110436;PD077004;H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn- Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-G ly-Ser-Asn-Thr-Tyr-NH2; H-KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2;
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. Myotropic activity of allatostatins in tenebrionid beetles
5. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.