Amylin, amide, rat

Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1190
CAS	124447-81-0
Synonyms/Alias	Amylin (rat)
M.F/Formula	C₁₆₇H₂₇₂N₅₂O₅₃S₂
M.W/Mr.	3920.44
Sequence	One Letter Code: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) three Letter Code: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7)

CAT#	Product Name	Inquiry
R1115	[Arg8]-Vasotocin TFA	Inquiry
R1980	DiaPep277	Inquiry
R1751	VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R1822	Met-Enkephalin	Inquiry
R1011	UFP 803	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.