CAT# | A12013 |
M.W/Mr. | 3903.3 |
Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...