Amylin (1-37), human, amide
Amylin (1-37), human, amide
Online Inquiry
| CAT# | A12013 |
| M.W/Mr. | 3903.3 |
| Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 |
| Length | 37 |
Modifications | disulfide |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| A12001 |
Amylin(20-29), Islet Amyloid Polypeptide, IAPP (20-29), rat |
|
|
Inquiry |
| A12019 |
Amylin (14-20) (human) |
|
|
Inquiry |
| A12014 |
Amylin, human, free acid |
|
|
Inquiry |
| A12017 |
Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide |
|
|
Inquiry |
| A12009 |
Amylin (8-37), human |
|
|
Inquiry |
Write a review
Ask a question
My Review for Amylin (1-37), human, amide
Required fields are marked with *
×
Ask a Question for Amylin (1-37), human, amide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
