CAT# | A12013 |
M.W/Mr. | 3903.3 |
Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 |
Length | 37 | Modifications | disulfide |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A12020 | Amylin (20-29) (human) | Inquiry | ||
A12009 | Amylin (8-37), human | Inquiry | ||
A12003 | Amylin(20-29), Islet Amyloid Polypeptide, IAPP (20-29), cat | Inquiry | ||
A12017 | Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide | Inquiry | ||
CAD-108 | Biotinyl-Amylin (human) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...