CAT# | AF3104 |
Sequence | MQKLAEAIAAAVQAGQDKDWGKMGTSIVGIVENGISVLGKIFGF |
Activity | Antibacterial |
Host Chemicals | Staphylococcus haemolyticus (strain JCSC1435) | Length | 44 | SwissProt ID | Q4L5M5 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF141 | Dybowskin-1CDYa | Inquiry | ||
AF880 | Prepropalustrin-2CE | Inquiry | ||
AF1550 | Lycocitin-3 | Inquiry | ||
AF931 | Kassinatuerin-1 | Inquiry | ||
AF2626 | Brevinin-2PRa | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...