Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | MQKLAEAIAAAVQAGQDKDWGKMGTSIVGIVENGISVLGKIFGF |
Activity | Antibacterial |
Host Chemicals | Staphylococcus haemolyticus (strain JCSC1435) |
Length | 44 |
SwissProt ID | Q4L5M5 |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
3. Myotropic activity of allatostatins in tenebrionid beetles
5. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.