Products
Home > Functional Peptides > Antimicrobial Peptides > Bacteriocin E50-52

If you find Creative Peptides is useful to satisfy your needs, please do not hesitate to contact us!

Bacteriocin E50-52

CAT#
AF2800
Sequence
TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA
Host Chemicals
Enterococcus faecium
Length
39
Activity
Antibacterial
SwissProt ID
P85148

Useful Tools

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry
  • Please enter the code "peptides"

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

Follow us on:

Copyright © 2008 - Creative Peptides. All rights reserved.

USA

Address: 45-16 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

E-Mail:

Europe

Tel: 44-207-097-1828

E-Mail: