CAT# | AF2800 |
Sequence | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA |
Activity | Antibacterial |
Host Chemicals | Enterococcus faecium | Length | 39 | SwissProt ID | P85148 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2839 | Myeloid cathelicidin 3 | Inquiry | ||
AF1577 | Ganodermin | Inquiry | ||
AF2939 | PP113 | Inquiry | ||
AF108 | Non-disulfide-bridged peptide 58 | Inquiry | ||
AF2913 | Anionic antimicrobial peptide 2, partial | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...