CAT# | AF2623 |
Sequence | GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR |
Activity | Antibacterial |
Host Chemicals | Bacillus phage SPbeta | Length | 37 | SwissProt ID | P68578 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1897 | Pleurain-N1 | Inquiry | ||
AF2471 | Defensin-related cryptdin-21 | Inquiry | ||
AF1582 | Hyst A | Inquiry | ||
AF1259 | Brevinin-1JDb | Inquiry | ||
AF2854 | Antimicrobial protein PN-AMP1 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...