Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | EGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR |
Activity | Antibacterial |
Host Chemicals | Bos taurus |
Length | 40 |
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.