Home > Product > Antimicrobial Peptides > Beta-defensin 1

Antimicrobial Peptides

Beta-defensin 1

Price Inquiry
CAT#
AF2404
Sequence
DQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCC
Host Chemicals
Canis lupus familiaris
Length
35
Activity
Antimicrobial
SwissProt ID
Q30KV2

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.