Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | DQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCC |
Activity | Antimicrobial |
Host Chemicals | Canis lupus familiaris |
Length | 35 |
SwissProt ID | Q30KV2 |
1. Implications of ligand-receptor binding kinetics on GLP-1R signalling
2. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
5. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.