Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR |
Activity | Antimicrobial |
Host Chemicals | Bos taurus |
Length | 36 |
SwissProt ID | P46163 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.