Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCRT |
Activity | Antibacterial |
Host Chemicals | Gallus gallus |
Length | 37 |
SwissProt ID | Q6QLQ9 |
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.