CAT# | AF2661 |
Sequence | NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCRT |
Activity | Antibacterial |
Host Chemicals | Gallus gallus | Length | 37 | SwissProt ID | Q6QLQ9 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1957 | Dicynthaurin | Inquiry | ||
AF3206 | Viscotoxin A1 | Inquiry | ||
AF2821 | Beta-defensin 9 , BNBD-9 | Inquiry | ||
AF1484 | Palustrin-RA2 antimicrobial peptide | Inquiry | ||
AF1335 | MSI-594 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...