CAT# | AF2900 |
Sequence | QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK |
Activity | Antibacterial |
Host Chemicals | Mus musculus | Length | 41 | SwissProt ID | Q91VD6 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2044 | Circulin-B | Inquiry | ||
AF711 | Uperin-2.4 | Inquiry | ||
AF040 | Odorranain-N1 | Inquiry | ||
AF2981 | RprDefC | Inquiry | ||
AF2491 | Beta-defensin 39 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...
Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...