Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL |
Activity | Antibacterial |
Host Chemicals | Mus musculus |
Length | 42 |
SwissProt ID | Q30KN3 |
1. Myotropic activity of allatostatins in tenebrionid beetles
2. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
3. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.