Keywords Search Google Search Search

Beta-defensin 5 precursor

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2855
Sequence	QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF838	Tu-AMP 2	Inquiry
AF3244	Palustrin-3b	Inquiry
AF2383	P9	Inquiry
AF3174	Esculentin-1V-HN1 antimicrobial peptide precursor	Inquiry
AF594	RTD-5	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

Function of enfuvirtide in HIV-1 infection

Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...

Function of a vasoactive peptide Endothelin-1

Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...

Function of KYL Solution on the Cold Preservation of Liver

Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...

A synthetic analogue of vasopressin - felypressin

Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Bos taurus
Length	40
SwissProt ID	P46163