Keywords Search Google Search Search

Beta-defensin114

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2991
Sequence	DRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF354	Brevinin-1SHb precursor	Inquiry
AF1604	Bombinin-like peptide 7, BPL-7	Inquiry
AF2157	Lichenicidin	Inquiry
AF1727	ChaC11	Inquiry
AF3235	SIalpha1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Methamphetamine and Substance P

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

Effect of GRF (Human) Acetate on Growth Hormone

Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...

Compstatin: a pharmaceutical inhibitor of complement

Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...

Linear Heptapeptide Antagonist, GR 94800

GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...

Desmopressin

Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Homo sapiens
Length	43
SwissProt ID	Q30KQ6