BNP (64-95), rat
Online Inquiry
| CAT# | B1813 |
| M.W/Mr. | 3452 |
| Sequence | One Letter Code: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26)
three Letter Code: NH2-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-COOH (Disulfide bridge: 10-26) |
| Source# | Synthetic |
Length | 32 |
Storage | -20 ± 5 °C |
Modifications | disulfide |
Write a review
Ask a question
My Review for BNP (64-95), rat
Required fields are marked with *
×
Ask a Question for BNP (64-95), rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
