Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3452 |
Sequence | One Letter Code: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26) three Letter Code: NH2-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-COOH (Disulfide bridge: 10-26) |
Source# | Synthetic |
Length | 32 |
Modifications | disulfide |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
4. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.