Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | WKPFKKIEKAVRRVRDGVAKAGPAVAVVGQAT |
Activity | Antibacterial, Antifungal |
Host Chemicals | Oiketicus kirbyi |
Length | 32 |
SwissProt ID | P83420 |
3. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.