Keywords Search Google Search Search

Chicken AvBD2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2375
Sequence	LFCKGGSCHFGGCPSHLIKVGSCFRSCCKWPWNA
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF357	Temporin-1Lb	Inquiry
AF402	BTL	Inquiry
AF543	Thiostrepton	Inquiry
AF985	Hominicin	Inquiry
AF2868	ARD1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

What is GHK and Copper Peptide?

Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...

The Function of CRF (ovine) Trifluoroacetate in Parkinson's Disease

Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...

Function of porcine secretin on cannulation of the dorsal pancreatic duct at ERCP in patients with pancreas divisum

Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...

Jingzhaotoxin-III, A Selective NaV1.5 Channel Blocker

Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...

Peptidic Antagonist to CRF2 Receptor–Astressin 2B

Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Gallus gallus
Length	34