CAT No: A13396
Synonyms/Alias: Citrullinated Aβ (1-42); Citrullinated Aβ42; R5C1-42
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C203H310N54O61S |
M.W/Mr. | 4515.02 |
Sequence | One Letter Code:DAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Three Letter Code:Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala |
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.