Home > Product > Antimicrobial Peptides > Defensin MGD-1 precursor

Antimicrobial Peptides

Defensin MGD-1 precursor

Price Inquiry
CAT#
AF2707
Sequence
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
Host Chemicals
Mytilus galloprovincialis
Length
38
Activity
Antibacterial
SwissProt ID
P80571

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.