Home > Product > Antimicrobial Peptides > Dermaseptin AA-3-6

Antimicrobial Peptides

Dermaseptin AA-3-6

Price Inquiry
CAT#
AF2106
Sequence
GMWSTIRNVGKSAAKAANLPAKAALGAISEAV
Host Chemicals
Agalychnis annae
Length
32
Activity
Antibacterial
SwissProt ID
O93226

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.