Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SLGSFMKGVGKGLATVGKIVADQFGKLLEA |
Activity | Antibacterial |
Host Chemicals | Agalychnis annae |
Length | 30 |
SwissProt ID | O93221 |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.