Home > Product > Antimicrobial Peptides > Enterocin X beta

Antimicrobial Peptides

Enterocin X beta

Price Inquiry
CAT#
AF2642
Sequence
IAPIIVAGLGYLVKDAWDHSDQIISGFKKGWNGGRRK
Host Chemicals
Enterococcus faecium KU-B5
Length
37
Activity
Antibacterial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.