CAT# | AF2632 |
Sequence | GVFSFLKTGAKLLGSTLLKMAGKAGAEHLACKATNQC |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...