Home > Product > Antimicrobial Peptides > Esculentin-2V-HN1 antimicrobial peptide precursor

Antimicrobial Peptides

Esculentin-2V-HN1 antimicrobial peptide precursor

Price Inquiry
CAT#
AF2504
Sequence
IFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQC
Host Chemicals
Odorrana hainanensis
Length
36
Activity
Antimicrobial
SwissProt ID
E7EKC7

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.