Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | IFTLFKGAAKLLGKTLAKEAGKTGLELMACKVTNQC |
Activity | Antimicrobial |
Host Chemicals | Odorrana hainanensis |
Length | 36 |
SwissProt ID | E7EKC7 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.