Galanin, human

Galanin (1-30), human is a 30-amino acid neuropeptide, and acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Galanin, human(CAS 119418-04-1)

CAT No: 10-101-317

CAS No:119418-04-1

Synonyms/Alias:119418-04-1;Galanin (1-30) (human);Galanin (1-30), human;CID 16133823;Galanin-1-30;DTXSID60583203;PUBCHEM_16133823;Galanin (human) trifluoroacetate salt;AKOS024456443;FG110297;Galanin human, >=97% (HPLC), powder;G12375;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C139H210N42O43
M.W/Mr.
3157.4
Sequence
One Letter Code:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Three Letter Code:H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
Purity
≥97% by HPLC

Galanin, human is a neuropeptide composed of 30 amino acids, widely distributed throughout the central and peripheral nervous systems of mammals. It is encoded by the GAL gene and exerts its biological effects through interaction with specific G protein-coupled receptors, including GALR1, GALR2, and GALR3. As a highly conserved regulatory peptide, galanin is recognized for its significant modulatory roles in neurotransmission, hormone secretion, and neuroendocrine signaling. Its multifaceted activity and involvement in diverse physiological processes have made it a focal point in neurobiological research, particularly in studies of neuronal communication, synaptic plasticity, and neuropeptide signaling pathways.

Neuroscience research: Galanin is widely utilized in neuroscience to elucidate the mechanisms of neuropeptide-mediated modulation of synaptic activity. By applying synthetic human galanin in in vitro or in vivo models, researchers can investigate its influence on neuronal excitability, neurotransmitter release, and synaptic plasticity. These studies have been instrumental in advancing the understanding of how neuropeptides modulate neural circuit functions, especially in regions such as the hippocampus, hypothalamus, and spinal cord, where galaninergic signaling is prominent.

Receptor pharmacology: The peptide serves as a critical tool for characterizing the pharmacological properties of galanin receptors. By employing human galanin in receptor binding assays, signal transduction studies, or functional bioassays, investigators can delineate receptor subtype specificity, ligand affinity, and downstream signaling pathways. Such research is essential for mapping the physiological roles of GALR1, GALR2, and GALR3, as well as for screening novel receptor agonists, antagonists, or modulators in drug discovery and neuropharmacology.

Peptide-receptor interaction studies: Human galanin is frequently employed to probe the structural and functional determinants of peptide-receptor interactions. Through mutagenesis, structure-activity relationship (SAR) analyses, and biophysical characterization, scientists can dissect the binding interfaces and conformational dynamics that underlie galanin's selective activation of its receptors. These insights are crucial for rational design of peptide analogs with tailored bioactivity or improved receptor selectivity, enabling more precise manipulation of galaninergic signaling in experimental systems.

Endocrine regulation research: The peptide is instrumental in studies examining the modulation of hormone secretion and neuroendocrine integration. Galanin has been shown to influence the release of several pituitary and hypothalamic hormones, such as growth hormone, prolactin, and luteinizing hormone, through direct and indirect actions on neuroendocrine cells. Experimental application of human galanin in isolated tissue preparations or cell-based assays allows for detailed analysis of its regulatory effects on hormone dynamics, contributing to a deeper understanding of neuropeptide-hormone crosstalk.

Peptide signaling pathway analysis: Human galanin is an essential reagent for dissecting complex neuropeptide signaling pathways in various model systems. By modulating galaninergic tone in neuronal cultures, brain slices, or animal models, researchers can evaluate downstream effects on gene expression, second messenger systems, and cellular responses. Such experiments are fundamental for mapping the broader physiological consequences of galanin signaling, clarifying its roles in stress response, energy homeostasis, and neural adaptation.

Length
30
Shipping Condition
RT, or blue ice upon request.
InChI
InChI=1S/C139H210N42O43/c1-65(2)38-84(165-121(206)86(40-67(5)6)166-123(208)88(43-75-31-33-79(188)34-32-75)161-106(193)55-151-114(199)70(11)157-131(216)97(59-182)175-127(212)95(49-104(144)191)170-122(207)87(41-68(7)8)173-136(221)112(72(13)186)180-130(215)90(159-105(192)51-141)44-76-52-150-81-27-19-18-26-80(76)81)116(201)154-58-109(196)181-37-23-30-101(181)134(219)172-91(45-77-53-147-63-155-77)120(205)158-71(12)115(200)178-111(69(9)10)135(220)153-57-108(195)162-94(48-103(143)190)126(211)168-92(46-78-54-148-64-156-78)125(210)164-83(29-22-36-149-139(145)146)119(204)174-98(60-183)132(217)167-89(42-74-24-16-15-17-25-74)124(209)176-99(61-184)133(218)171-96(50-110(197)198)128(213)163-82(28-20-21-35-140)118(203)169-93(47-102(142)189)117(202)152-56-107(194)160-85(39-66(3)4)129(214)179-113(73(14)187)137(222)177-100(62-185)138(223)224/h15-19,24-27,31-34,52-54,63-73,82-101,111-113,150,182-188H,20-23,28-30,35-51,55-62,140-141H2,1-14H3,(H2,142,189)(H2,143,190)(H2,144,191)(H,147,155)(H,148,156)(H,151,199)(H,152,202)(H,153,220)(H,154,201)(H,157,216)(H,158,205)(H,159,192)(H,160,194)(H,161,193)(H,162,195)(H,163,213)(H,164,210)(H,165,206)(H,166,208)(H,167,217)(H,168,211)(H,169,203)(H,170,207)(H,171,218)(H,172,219)(H,173,221)(H,174,204)(H,175,212)(H,176,209)(H,177,222)(H,178,200)(H,179,214)(H,180,215)(H,197,198)(H,223,224)(H4,145,146,149)/t70-,71-,72+,73+,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,111-,112-,113-/m0/s1
InChI Key
CBSXZYWGVAQSHI-RUKUCZSXSA-N
Canonical SMILES
CC(C)CC(C(=O)NC(C(C)O)C(=O)NC(CO)C(=O)O)NC(=O)CNC(=O)C(CC(=O)N)NC(=O)C(CCCCN)NC(=O)C(CC(=O)O)NC(=O)C(CO)NC(=O)C(CC1=CC=CC=C1)NC(=O)C(CO)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC2=CNC=N2)NC(=O)C(CC(=O)N)NC(=O)CNC(=O)C(C(C)C)NC(=O)C(C)NC(=O)C(CC3=CNC=N3)NC(=O)C4CCCN4C(=O)CNC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC5=CC=C(C=C5)O)NC(=O)CNC(=O)C(C)NC(=O)C(CO)NC(=O)C(CC(=O)N)NC(=O)C(CC(C)C)NC(=O)C(C(C)O)NC(=O)C(CC6=CNC7=CC=CC=C76)NC(=O)CN

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesCustom Conjugation ServicePeptide Modification ServicescGMP Peptide ServiceEpitope Mapping ServicesPeptide CDMOPeptide Nucleic Acids SynthesisPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers