Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 5002.7 |
Sequence | One Letter Code:YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ Three Letter Code:Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln |
Length | 42 |
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.