Home > Product > Catalog Peptides > β-Amyloid Mutations > [Gln22]-beta-Amyloid (1-40), Dutch Mutation

β-Amyloid Mutations

[Gln22]-beta-Amyloid (1-40), Dutch Mutation

Price Inquiry
CAT#
A13273
Sequence
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
M.W/Mr.
4328.9
Length
40

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.