Home > Product > Antimicrobial Peptides > GNCP-2

Antimicrobial Peptides

CAT#
AF1968
Sequence
RCICTTRTCRFPYRRLGTCLFQNRVYTFCC
Host Chemicals
Cavia porcellus
Length
30
Activity
Antimicrobial
SwissProt ID
P49112

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.