Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C194H317N61O63S1 |
M.W/Mr. | 4544.1 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA |
Length | 40 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
4. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.