CAT# | G09006 |
M.F/Formula | C194H317N61O63S1 |
M.W/Mr. | 4544.1 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA |
Length | 40 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G09002 | GRF (1-29) amide (human) | Inquiry | ||
G09014 | Growth Hormone (6-13), human | Inquiry | ||
G09010 | GRF (porcine) | Inquiry | ||
G09005 | Growth Hormone Releasing Factor, GRF (1 - 40), amide, human | Inquiry | ||
G09004 | Growth Hormone Pro-Releasing Factor, human | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...