Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C188H291N53O40S2 |
M.W/Mr. | 3997.78 |
Sequence | One Letter Code:RQIKIWFQNRRMKWKKMIASHLLAYFFTELN-NH2 Three Letter Code:Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Ile-Ala-Ser-His-Leu-Leu-Ala-Tyr-Phe-Phe-Thr-Glu-Leu-Asn-NH2 |
2. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
3. Myotropic activity of allatostatins in tenebrionid beetles
4. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.