Hexokinase II VDAC binding domain peptide

Hexokinase II VDAC Binding Domain Peptide reproduces the mitochondrial-anchoring segment recognized by VDAC at the outer membrane. Hydrophobic and basic residues arrange to interact with the channel surface. Researchers use it to map binding interfaces, study metabolic coupling, and disrupt protein-protein association in model systems. Applications include mitochondrial biology, interaction mapping, and peptide-competition assays.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2861

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C188H291N53O40S2
M.W/Mr.
3997.78
Sequence
One Letter Code:RQIKIWFQNRRMKWKKMIASHLLAYFFTELN-NH2
Three Letter Code:Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Ile-Ala-Ser-His-Leu-Leu-Ala-Tyr-Phe-Phe-Thr-Glu-Leu-Asn-NH2

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Modification ServicesPeptide Synthesis ServicesPeptide CDMOPeptide Analysis ServicesEpitope Mapping ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers