Keywords Search Google Search Search

LL-37, reverse sequence

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	L07002
M.W/Mr.	4493.3
Sequence	SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

CAT#	Product Name	Inquiry
L07006	KR-12 (human)	Inquiry
L07008	LL-37 amide	Inquiry
L07001	LL-37, Antimicrobial Peptide, human	Inquiry
L07004	Cys-LC-LL-37	Inquiry
L07005	Biotinyl-LL-37 amide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Overview of tetrapeptide-26

Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...

CXCR4 antagonist-TC 14012

TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...

Function of dynorphin A (1-13) in ischemic brain injury

Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...

The Function of Dalbavancin in Acute Bacterial Skin and Skin Tissue Infections (ABSSSI)

Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...

What is PT-141?

PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: