CAT# | L07002 |
M.W/Mr. | 4493.3 |
Sequence | SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL |
Length | 37 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
L07004 | Cys-LC-LL-37 | Inquiry | ||
L07006 | KR-12 (human) | Inquiry | ||
L07005 | Biotinyl-LL-37 amide | Inquiry | ||
L07008 | LL-37 amide | Inquiry | ||
L07001 | LL-37, Antimicrobial Peptide, human | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...