Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4328.9 |
Sequence | DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV |
Length | 40 |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. Myotropic activity of allatostatins in tenebrionid beetles
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.