Maxadilan trifluoroacetate salt

Maxadilan trifluoroacetate salt is a long, flexible peptide with defined helical and loop regions supporting complex receptor interactions. Its amphipathic architecture aids in exploring folding transitions and binding determinants. The trifluoroacetate form enhances handling and solubility. Applications include ligand-receptor modeling and structural peptide research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C0102

CAS No:135374-80-0

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₉₁H₄₆₆N₈₆O₉₄S₆
M.W/Mr.
6865.82
Sequence
CDATCQFRKAIDDCQKQAHHSNVLQTSVQTTATFTSMDTSQLPGNSVFKECMKQKKKEFKA-NH₂
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesisEpitope Mapping ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Synthesis ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers