Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLAN |
Activity | Antimicrobial |
Host Chemicals | Bos indicus x Bos taurus (hybrid cattle) |
Length | 45 |
SwissProt ID | Q0MRQ0 |
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.