Keywords Search Google Search Search

Neutrophil beta defensin 12

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2512
Sequence	LLALLFLVLSAGSGFTQGVGNPVSCARNKGICVPSR
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF2722	Moricin-like peptide D	Inquiry
AF1108	Brevinin-1-RAB1 peptide precursor	Inquiry
AF2546	Granulosusin-C1 antimicrobial peptide precursor	Inquiry
AF810	Bombinin H1	Inquiry
AF2235	Brevinin-2-RA20 antimicrobial peptide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

Function of teriparatide in the treatment of osteoporosis

Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...

Effect of GRF (Human) Acetate on Growth Hormone

Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...

The medical value of MCL 0020

MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...

KAI-1455: A selective ε-protein kinase C activator

KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Bubalus bubalis
Length	36
SwissProt ID	C7E003