Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA |
Length | 48 |
Modifications | D-serine (Ser)(46);Disulfide bond(4) |
2. Myotropic activity of allatostatins in tenebrionid beetles
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.