Keywords Search Google Search Search

Opistoporin4

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3088
Sequence	GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATPS
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF1743	Raniseptin-2	Inquiry
AF3188	Esculentin-1	Inquiry
AF1002	Hepcidin	Inquiry
AF1338	Ascaphin-5M	Inquiry
AF2257	Dermaseptin-6	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of L-Ornithine α-Ketoglutarate Monohydrate in Cerebral Hypoxia

L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...

Function of mambalgin 1 in inhibiting acid-sensing ion channels

Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...

Function of myristoyl pentapeptide-7 in skin and eyelash

Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...

The Function of AdTx1 for α1A-adrenoceptor

AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...

A highly selective intravenous anesthetic agent- Etomidate

Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Opistophthalmus carinatus
Length	44
SwissProt ID	Q5VJS9