Home > Product > Antimicrobial Peptides > Pardaxin Pa4

Antimicrobial Peptides

Pardaxin Pa4

Price Inquiry
CAT#
AF2183
Sequence
GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
Host Chemicals
Pardachirus marmoratus
Length
33
Activity
Antimicrobial
SwissProt ID
P81861

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.