PBD-1

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

SequenceOne Letter Code:NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6
Three Letter Code:Asn-Ile-Gly-Asn-Ser-Val-Ser-Cys-Leu-Arg-Asn-Lys-Gly-Val-Cys-Met-Pro-Gly-Lys-Cys-Ala-Pro-Lys-Met-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Met-Pro-Gln-Val-Lys-Cys-Cys-Lys-Arg-Lys (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6)
ActivityAntibacterial
Host ChemicalsSus scrofa
Length37
Write a review Ask a question
My Review for PBD-1

Required fields are marked with *

  • Basic Information
×
Ask a Question for PBD-1

Required fields are marked with *

  • Basic Information
×
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Aviptadil Acetate

    Aviptadil, also known as vasoactive intestinal polypeptide (VIP), is a 28 amino acid neuropeptide that belongs to the glucagon-growth hormone-releasing factor secretion superfamily. Aviptadil acts as a potent systemic vasodilator and bronchodilator. It inhibits the proliferation of vascular and bronchial smooth muscle cells and decreases platelet aggregation. These biological effects are mediated by specific VIP receptors.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • Thymopentin Acetate

    Thymopentin, also known as TP-5, is a synthetic derivative of thymopoietin, a thymic hormone, and has immunoregulatory properties. Thymopentin interacts with T cells, reduces endocrine and behavioral responses to experimental stress. It is also found to increase the number of cells undergoing apoptosis in irradiated cells and selectively bind to apoptotic cells.

    Inquiry
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Antide

    Antide acetate (Ac-AA10-NH2) is an LHRH antagonist and represses LH and FSH release from the pituitary gland. It shows a high antiovulatory activity and releases negligible histamine.

    Inquiry
  • Argipressin

    Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

    Inquiry
  • Terlipressin

    Terlipressin is a synthetic triglycyllysine derivative of vasopressin with vasoconstrictive, antihemorrhagic, and antidiuretic properties. Upon intravenous administration, terlipressin, an inactive prodrug, is biotransformed to its active moiety, lysine vasopressin (LVP), a nonselective vasopressin analogue with affinity for vasopressin receptors V1 (V1a), V2 and V3 (V1b). As a V1 agonist, terlipressin increases systemic vascular resistance, particularly in the splanchnic area, resulting in a decrease of portal pressure. V1 binding also promotes platelet aggregation and glycogenolysis, while V3 binding induces adrenocorticotropic hormone (ACTH) secretion. Compared to vasopressin, terlipressin has a minimal effect on V2 receptors, which are responsible for promotion of water reabsorption in the collecting ducts of the kidney via stimulation of cyclic AMP production.

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.