This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4771.4 |
Sequence | One Letter Code: [protein fragment, 39 aa] Three Letter Code: H-Lys-Thr-Phe-Cys-Gly-Thr-Pro-Glu-Tyr-Leu-Ala-Pro-Glu-Val-Arg-Arg-Glu-Pro-Arg-Ile-Leu-Ser-Glu-Glu-Glu-Gln-Glu-Met-Phe-Arg-Asp-Phe-Asp-Tyr-Ile-Ala-Asp-Trp-Cys-OH |
References | 1. Biondi, R.M. et al. EMBO J. 19, 979 (2000).; 2. Komander, D. et al. Structure 12, 215 (2004). |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.