Peptide YY (PYY), human

Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Peptide YY (PYY), human(CAS 118997-30-1)

CAT No: R1612

CAS No:118997-30-1

Synonyms/Alias:Peptide yy human;118997-30-1;Peptide YY (human);Peptide YY [MI];Peptide yy (1-36);PYY (1-36) peptide;Peptide YY (human) trifluoroacetate salt;PYY;UNII-T2670C12I5;PYY(1-36);T2670C12I5;DA-56694;FP110394;G12304;H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Ar g-Gln-Arg-Tyr-NH2; H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C194H295N55O57
M.W/Mr.
4310
Sequence
One Letter Code:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Three Letter Code:H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Peptide YY (PYY), human is an endogenous peptide hormone belonging to the pancreatic polypeptide-fold family, naturally produced in the gastrointestinal tract. Structurally, it is a 36-amino acid peptide released primarily by L-cells in the distal gut in response to food intake. PYY plays a critical role in regulating digestive physiology, appetite, and energy homeostasis by binding to specific Y receptors, particularly Y2 and Y1 subtypes. Its physiological relevance and intricate signaling mechanisms have made it a central focus for research into gastrointestinal function, metabolic regulation, and neuroendocrine signaling.

Appetite Regulation Studies: PYY is widely utilized in experimental models investigating the biochemical and neuroendocrine pathways underlying appetite control. Researchers employ this peptide in in vitro and in vivo systems to elucidate its inhibitory effects on food intake, mediated through hypothalamic signaling and modulation of neuropeptide Y (NPY) neuron activity. Such studies enable a clearer understanding of the molecular mechanisms that govern satiety signaling and energy balance, providing valuable insights into metabolic disorders and obesity.

Gastrointestinal Motility Research: The peptide serves as a functional tool for dissecting the regulatory effects of gut hormones on intestinal motility and secretion. Its ability to interact with enteric nervous system receptors allows scientists to examine how PYY modulates peristalsis, gastric emptying, and secretion of digestive enzymes. These investigations are essential for mapping the complex neurogastroenterological networks that coordinate nutrient processing and absorption.

Endocrine and Paracrine Signaling Analysis: PYY is a key component in studies exploring the interplay between endocrine and paracrine signaling within the gut-brain axis. By applying the peptide in cell-based assays or organotypic models, researchers can characterize its influence on hormone release, neuronal activation, and cross-talk with other gastrointestinal peptides such as GLP-1 and oxyntomodulin. Such analyses are crucial for unraveling the integrated regulatory circuits involved in digestion and systemic metabolic responses.

Receptor Pharmacology and Signal Transduction: The peptide is instrumental in receptor binding assays, functional studies, and signal transduction research focused on Y receptor subtypes. By employing PYY as a ligand, investigators can delineate receptor specificity, affinity, and downstream intracellular signaling cascades. These applications support the development of selective receptor modulators and enhance the understanding of G protein-coupled receptor (GPCR) biology in the context of gastrointestinal and metabolic control.

Peptide Engineering and Structure-Function Studies: PYY is also valuable for peptide chemistry and structure-activity relationship investigations. Its well-defined sequence and biological activity provide a model for synthesizing analogs, truncations, or labeled derivatives to probe critical residues involved in receptor interaction and functional outcomes. Such studies facilitate the design of novel peptide-based probes or modulators with tailored pharmacological properties for advanced research applications.

InChI
InChI=1S/C194H295N55O57/c1-17-99(12)154(244-183(299)143-36-25-73-247(143)188(304)115(196)80-104-37-47-110(253)48-38-104)185(301)228-125(28-18-19-67-195)189(305)248-74-26-34-141(248)181(297)225-122(59-64-149(264)265)159(275)218-102(15)187(303)246-72-24-33-140(246)180(296)214-90-147(261)219-120(58-63-148(262)263)164(280)240-137(88-152(270)271)169(285)217-101(14)158(274)242-139(92-251)190(306)249-75-27-35-142(249)182(298)226-124(61-66-151(268)269)166(282)224-123(60-65-150(266)267)167(283)230-128(77-95(4)5)171(287)238-135(86-145(198)259)176(292)222-117(30-21-69-211-192(203)204)162(278)234-132(83-107-43-53-113(256)54-44-107)174(290)235-131(82-106-41-51-112(255)52-42-106)168(284)216-100(13)157(273)241-138(91-250)179(295)233-127(76-94(2)3)170(286)221-118(31-22-70-212-193(205)206)163(279)237-134(85-109-89-209-93-215-109)175(291)236-133(84-108-45-55-114(257)56-46-108)173(289)231-129(78-96(6)7)172(288)239-136(87-146(199)260)177(293)232-130(79-97(8)9)178(294)243-153(98(10)11)184(300)245-155(103(16)252)186(302)227-119(32-23-71-213-194(207)208)160(276)223-121(57-62-144(197)258)165(281)220-116(29-20-68-210-191(201)202)161(277)229-126(156(200)272)81-105-39-49-111(254)50-40-105/h37-56,89,93-103,115-143,153-155,250-257H,17-36,57-88,90-92,195-196H2,1-16H3,(H2,197,258)(H2,198,259)(H2,199,260)(H2,200,272)(H,209,215)(H,214,296)(H,216,284)(H,217,285)(H,218,275)(H,219,261)(H,220,281)(H,221,286)(H,222,292)(H,223,276)(H,224,282)(H,225,297)(H,226,298)(H,227,302)(H,228,301)(H,229,277)(H,230,283)(H,231,289)(H,232,293)(H,233,295)(H,234,278)(H,235,290)(H,236,291)(H,237,279)(H,238,287)(H,239,288)(H,240,280)(H,241,273)(H,242,274)(H,243,294)(H,244,299)(H,245,300)(H,262,263)(H,264,265)(H,266,267)(H,268,269)(H,270,271)(H4,201,202,210)(H4,203,204,211)(H4,205,206,212)(H4,207,208,213)/t99-,100-,101-,102-,103+,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,153-,154-,155-/m0/s1
InChI Key
YNXLOPYTAAFMTN-SBUIBGKBSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesisPeptide Analysis ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers